(data stored in ACNUC30630 zone)

EMBL: CP001096.PE422

CP001096.PE422       Location/Qualifiers
FT   CDS             complement(454807..455334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0424"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   bbt:BBta_0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98984"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA98"
FT                   /protein_id="ACE98984.1"
FT                   /translation="MLDKLRQFITDVVAPSAPDELMLDDGGYRLAATALLIHVISIDGD
FT                   PSEVEKQKLHSLLEQRFGLDAATATRLIASATLVEGEAVDLYHFTSVIMRSVNEQGRLR
FT                   IVEMMWELVYADGTVTEFEENVVWRAADLLAISTRDRVTLRQKVAAAAPVAPGAAQGGT
FT                   AMGSVAEVDPAN"
     MLDKLRQFIT DVVAPSAPDE LMLDDGGYRL AATALLIHVI SIDGDPSEVE KQKLHSLLEQ        60
     RFGLDAATAT RLIASATLVE GEAVDLYHFT SVIMRSVNEQ GRLRIVEMMW ELVYADGTVT       120
     EFEENVVWRA ADLLAISTRD RVTLRQKVAA AAPVAPGAAQ GGTAMGSVAE VDPAN            175
//

If you have problems or comments...

PBIL Back to PBIL home page