(data stored in ACNUC30630 zone)

EMBL: CP001096.PE43

CP001096.PE43        Location/Qualifiers
FT   CDS             complement(47716..48828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0043"
FT                   /product="domain of unknown function DUF1730"
FT                   /note="PFAM: domain of unknown function DUF1730; KEGG:
FT                   bja:bll0714 iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98605"
FT                   /db_xref="GOA:B3Q5X6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X6"
FT                   /protein_id="ACE98605.1"
FT                   /translation="MKARLAEQARALGFDAFGICAPDSIPEAPARLRAFLDAGYHGEMA
FT                   WLADRPERRSDPRVMWSEVQSVILLGFNYGPDADPRAVLTQKDRGAISVYAQGDDYHDV
FT                   IKARLKQFARWLVATGGGDVKVFIDTAAVMEKPLAQAAGLGWQGRHTNLVSKGRGSWMF
FT                   LGAVFTTLDLPRDAAEGDHCGSCRACLDACPTAAFPAPYQLDARRCISYLTIEHKGPIP
FT                   REFRARLGNRIYGCDDCLAACPWNKFAQAGREAKLAARDALRAPALGELVRLDDPSFRA
FT                   LFTKSPVKRIGRDRFIRNALIAIGNSGDAELAPEAERLLADPSPTIRGAAAWALAQLLP
FT                   PERVATLKAVHLAAEVDDGVRAEWGGFAAE"
     MKARLAEQAR ALGFDAFGIC APDSIPEAPA RLRAFLDAGY HGEMAWLADR PERRSDPRVM        60
     WSEVQSVILL GFNYGPDADP RAVLTQKDRG AISVYAQGDD YHDVIKARLK QFARWLVATG       120
     GGDVKVFIDT AAVMEKPLAQ AAGLGWQGRH TNLVSKGRGS WMFLGAVFTT LDLPRDAAEG       180
     DHCGSCRACL DACPTAAFPA PYQLDARRCI SYLTIEHKGP IPREFRARLG NRIYGCDDCL       240
     AACPWNKFAQ AGREAKLAAR DALRAPALGE LVRLDDPSFR ALFTKSPVKR IGRDRFIRNA       300
     LIAIGNSGDA ELAPEAERLL ADPSPTIRGA AAWALAQLLP PERVATLKAV HLAAEVDDGV       360
     RAEWGGFAAE                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page