(data stored in ACNUC30630 zone)

EMBL: CP001096.PE430

CP001096.PE430       Location/Qualifiers
FT   CDS             complement(462579..463097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_3604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98992"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA6"
FT                   /protein_id="ACE98992.1"
FT                   /translation="MLLRLPVITAAMLAVVGLAHADDDELAIQGIGISRDIDCQGKNVG
FT                   VYGAENEIALTGQCRTITVHGSKHKVSFEQGQTLSVSGSDNTVNGGRAKDVVVSVAKNT
FT                   VTTTLEAGDEPGTLKATGANNKITLVLSGPSRLDVGGVEQVVEWSKADGAPNPEVRSSG
FT                   ALNSIKRKK"
     MLLRLPVITA AMLAVVGLAH ADDDELAIQG IGISRDIDCQ GKNVGVYGAE NEIALTGQCR        60
     TITVHGSKHK VSFEQGQTLS VSGSDNTVNG GRAKDVVVSV AKNTVTTTLE AGDEPGTLKA       120
     TGANNKITLV LSGPSRLDVG GVEQVVEWSK ADGAPNPEVR SSGALNSIKR KK               172
//

If you have problems or comments...

PBIL Back to PBIL home page