(data stored in ACNUC30630 zone)

EMBL: CP001096.PE441

CP001096.PE441       Location/Qualifiers
FT   CDS             complement(478294..479073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0443"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   bbt:BBta_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99003"
FT                   /db_xref="GOA:B3QAB7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAB7"
FT                   /protein_id="ACE99003.1"
FT                   /translation="MTEPTPAVPETDDLAEPRLVIEPGVAARFCAVAEPVLMAMGYRLV
FT                   RIKVSGDAGCTVQIMAERPDGTMLIDDCEAASRALSPVLDVADPIDRAYRLEISSPGID
FT                   RPLVRRSDFARYAGHLVKIEMAVPHQGRKRYRGLLDGVEGDAVRVQREGATKDEDPLVL
FT                   LPMHDIGDARLVLTDELIAESMRRGKQAERDLKQSLGLAPEPPPHAKRSDPKKSHAPKR
FT                   GPKAAKAPTKPKPQNTKQHRLAADKARRGEIDTSEGD"
     MTEPTPAVPE TDDLAEPRLV IEPGVAARFC AVAEPVLMAM GYRLVRIKVS GDAGCTVQIM        60
     AERPDGTMLI DDCEAASRAL SPVLDVADPI DRAYRLEISS PGIDRPLVRR SDFARYAGHL       120
     VKIEMAVPHQ GRKRYRGLLD GVEGDAVRVQ REGATKDEDP LVLLPMHDIG DARLVLTDEL       180
     IAESMRRGKQ AERDLKQSLG LAPEPPPHAK RSDPKKSHAP KRGPKAAKAP TKPKPQNTKQ       240
     HRLAADKARR GEIDTSEGD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page