(data stored in ACNUC30630 zone)

EMBL: CP001096.PE45

CP001096.PE45        Location/Qualifiers
FT   CDS             49765..50571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0045"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: bja:blr0716 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98607"
FT                   /db_xref="GOA:B3Q5X8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5X8"
FT                   /protein_id="ACE98607.1"
FT                   /translation="MLIDIIRAVILGIVEGVTEFLPVSSTGHLLLAERFFNLGEGNFWK
FT                   SFAVLIQLGAILAILALYFVKLWRIALGMFTDANARRFVIGVLVAFLPAAVIGAAFGGY
FT                   IKHYLFNPWVVCFSLIVGGAILLWVDQLDLKPRYHDATAFPLLTYFYIGCAQCTAMIPG
FT                   VSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKNHADMTADNLIIVAIG
FT                   FVVSFITAIIVVKTFLTYVTRHGFELFAWWRVIVGTLGLIALALGL"
     MLIDIIRAVI LGIVEGVTEF LPVSSTGHLL LAERFFNLGE GNFWKSFAVL IQLGAILAIL        60
     ALYFVKLWRI ALGMFTDANA RRFVIGVLVA FLPAAVIGAA FGGYIKHYLF NPWVVCFSLI       120
     VGGAILLWVD QLDLKPRYHD ATAFPLLTYF YIGCAQCTAM IPGVSRSGAS IVAAMLLGTD       180
     KRSAAEFSFF LAIPTMLGAF VYDLYKNHAD MTADNLIIVA IGFVVSFITA IIVVKTFLTY       240
     VTRHGFELFA WWRVIVGTLG LIALALGL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page