(data stored in ACNUC30630 zone)

EMBL: CP001096.PE450

CP001096.PE450       Location/Qualifiers
FT   CDS             complement(487356..488747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0452"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bja:bll0795 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99012"
FT                   /db_xref="GOA:B3QAC6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAC6"
FT                   /protein_id="ACE99012.1"
FT                   /translation="MSPPRKLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLV
FT                   ILNTCHIREKASEKVYSELGRLRVARDEAANHGRRMQIAVAGCVAQAEGEEIIRRAPVV
FT                   DVVVGPQSYHNLPQLLAKAEQHGRALETEFPIEDKFGVLPQPAPDAIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEMSRPVVAIVEDVKRLAENGVREVTLIGQNVNAYHGDGPDG
FT                   RAWSLGRLVRRLAEIPGIVRLRYSTSHPNDVDDDLLAAHRDLPALMPFVHLPVQSGSDR
FT                   ILAAMNRKHTADDYRRVIDRFRSASETIAFSSDFIVGFPGETERDFSATLALVAQIGYA
FT                   GAYSFKYSPRPGTPAADMVEMVPAAVMDERLEQLQQLIDQQQSAFNKAAIGRTVEVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVMAPDSIIGKVLPVRVDSLERYSLLGELASATSRPADAM
FT                   AATGA"
     MSPPRKLHIK SYGCQMNVYD AQRMVDALAP EGFVETANVD DADLVILNTC HIREKASEKV        60
     YSELGRLRVA RDEAANHGRR MQIAVAGCVA QAEGEEIIRR APVVDVVVGP QSYHNLPQLL       120
     AKAEQHGRAL ETEFPIEDKF GVLPQPAPDA IRARGISAFV TVQEGCDKFC TFCVVPYTRG       180
     AEMSRPVVAI VEDVKRLAEN GVREVTLIGQ NVNAYHGDGP DGRAWSLGRL VRRLAEIPGI       240
     VRLRYSTSHP NDVDDDLLAA HRDLPALMPF VHLPVQSGSD RILAAMNRKH TADDYRRVID       300
     RFRSASETIA FSSDFIVGFP GETERDFSAT LALVAQIGYA GAYSFKYSPR PGTPAADMVE       360
     MVPAAVMDER LEQLQQLIDQ QQSAFNKAAI GRTVEVLFER AGRKPGQIVG RTAYLQPAHV       420
     MAPDSIIGKV LPVRVDSLER YSLLGELASA TSRPADAMAA TGA                         463
//

If you have problems or comments...

PBIL Back to PBIL home page