(data stored in ACNUC30630 zone)

EMBL: CP001096.PE466

CP001096.PE466       Location/Qualifiers
FT   CDS             complement(504677..505663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0468"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: nha:Nham_0428 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99028"
FT                   /db_xref="GOA:B3QAE2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE2"
FT                   /protein_id="ACE99028.1"
FT                   /translation="MPGETGASKPIDLLIYGPRKEVIDQGFPAGYVLHKCERADDLEKL
FT                   SDEARGRIRGIAVTGLVPTGAAMLARFPKLEIVASFGVGYDHVDSAWAAQHGIIVTNTP
FT                   DVLTEEVADTALGLLIATLREFIRADKYVRAGQWQTQDYPLSTGSLRDRKVGMVGMGRI
FT                   GQAIARRLDAALVPVVYHSRNPAPGVAYKHYPNLIEMAKEVDTLVVITPGGPTTAKLIN
FT                   AEVLDALGPRGVVINVARGSVIDEAALIEALKSGKILAAGLDVFAAEPTVPEELRAMDN
FT                   VVLLPHIGSASVVTRNAMNQLVVDNLKAWFSGRPPLTPVAETPVKGR"
     MPGETGASKP IDLLIYGPRK EVIDQGFPAG YVLHKCERAD DLEKLSDEAR GRIRGIAVTG        60
     LVPTGAAMLA RFPKLEIVAS FGVGYDHVDS AWAAQHGIIV TNTPDVLTEE VADTALGLLI       120
     ATLREFIRAD KYVRAGQWQT QDYPLSTGSL RDRKVGMVGM GRIGQAIARR LDAALVPVVY       180
     HSRNPAPGVA YKHYPNLIEM AKEVDTLVVI TPGGPTTAKL INAEVLDALG PRGVVINVAR       240
     GSVIDEAALI EALKSGKILA AGLDVFAAEP TVPEELRAMD NVVLLPHIGS ASVVTRNAMN       300
     QLVVDNLKAW FSGRPPLTPV AETPVKGR                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page