(data stored in ACNUC30630 zone)

EMBL: CP001096.PE473

CP001096.PE473       Location/Qualifiers
FT   CDS             513809..514759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99035"
FT                   /db_xref="GOA:B3QAE9"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE9"
FT                   /protein_id="ACE99035.1"
FT                   /translation="MQYADRVIVRIVKDYCDASGVDVTLGLDGWLIVLSKGDARHFIYG
FT                   YDFGLNSSVTHRLANDKAATADILAAAGIACVPHRLFMNHEHFKYVPSSGHWSAMLKMQ
FT                   RAHPAGLVLKPNEGTCGHLVFKATTELELELAATAIFAANQNLAIAPYFDIAREVRVIL
FT                   LDRVPMVVYEKKRPTIIGDGARSALQLLLDAVPADRLGAVLANLPAGHAALDAVVPAGA
FT                   QFPLDWRHNLEFGAEPELIGDGELRDTCVAIAAEAARAIGLSFGAVDVVWTAQGPRVLE
FT                   INSGVMIESLSRRFPDLAQQVYTRALDRVMQAMPA"
     MQYADRVIVR IVKDYCDASG VDVTLGLDGW LIVLSKGDAR HFIYGYDFGL NSSVTHRLAN        60
     DKAATADILA AAGIACVPHR LFMNHEHFKY VPSSGHWSAM LKMQRAHPAG LVLKPNEGTC       120
     GHLVFKATTE LELELAATAI FAANQNLAIA PYFDIAREVR VILLDRVPMV VYEKKRPTII       180
     GDGARSALQL LLDAVPADRL GAVLANLPAG HAALDAVVPA GAQFPLDWRH NLEFGAEPEL       240
     IGDGELRDTC VAIAAEAARA IGLSFGAVDV VWTAQGPRVL EINSGVMIES LSRRFPDLAQ       300
     QVYTRALDRV MQAMPA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page