(data stored in ACNUC30630 zone)

EMBL: CP001096.PE488

CP001096.PE488       Location/Qualifiers
FT   CDS             complement(530401..530670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0491"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   nha:Nham_0505 RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99050"
FT                   /db_xref="GOA:B3QAG4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG4"
FT                   /protein_id="ACE99050.1"
FT                   /translation="MERQRLDKWLWHARVVRARTSAAALVERGHVRINGVRETSPGHGI
FT                   KVGDVLTIALDRGVRVLKVVGFTERRGDAESVTGLYADLGMPRE"
     MERQRLDKWL WHARVVRART SAAALVERGH VRINGVRETS PGHGIKVGDV LTIALDRGVR        60
     VLKVVGFTER RGDAESVTGL YADLGMPRE                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page