(data stored in ACNUC30630 zone)

EMBL: CP001096.PE489

CP001096.PE489       Location/Qualifiers
FT   CDS             complement(530701..533982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0492"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: nha:Nham_0504
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99051"
FT                   /db_xref="GOA:B3QAG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG5"
FT                   /protein_id="ACE99051.1"
FT                   /translation="MPNLYSEAFTADRVPGAGVTAVLGPTNTGKTHLAIERMVAHPSGL
FT                   IGLPLRLLAREVYNKIVDKVGANAVALVTGEEKIKPSKPRYWVSTVEAMPRDLDVSFLA
FT                   VDEIQIAADLERGHVFTDRILRRRGRDETLLLGAATMRPMIERLLPGASIVTRPRLSQL
FT                   EYAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQVAMFQ
FT                   SGDVDYLIATDAIGMGLNLDVDHVAFASDRKFDGYQFRRLTPAEFAQIGGRAGRATRDG
FT                   TFGTTGRCAPFEPELVNALQNHSFEPVKMLQWRNAELDFASIGALQVSLAESPRHEALT
FT                   RAPVAEDLRVLDHVARDAEVREIAQGKAAVERLWDVCQVPDYRKIAPAAHAELVITLYR
FT                   FLMQKGRIPDSWFAAQVDQADRTDGGIDTLSARIAQIRTWTFVANRPDWLADPEHWQGI
FT                   SRDVENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHVIGRLD
FT                   GFTFAPDAAEAGSDAKALQATAQKALAGEIDARAEKLSNAPDDQFILTSDGTIRWTGDA
FT                   VARLVGSDDVLRPRLRIIADDRLAGAPREAVQTRLDLWLKTHVEKILGPLFELGKAEDV
FT                   SGIARGIAFQLIESLGVLERAKIATEMKDLDQPSRATLRKYGVRFGAYHIYFPSLLKPA
FT                   ARALASLLWAQKQDNVDLAALSSAQHLAGSGRTSFPADKALDRDAYRTLGYRLCGERAV
FT                   RVDILERLADLIRPALAWREGASGEKPAGAFDGRSFVVTQAMTSLTGSAGEDFASILKA
FT                   LGYRMERRPAPPPAPKAAETASPATEEAAATSDMSAEDQAILAGAIAFEPSPTAEGDVA
FT                   EAAPTVDEQPAADEPAAVDQPVATAAEPAAEAAAAETAEQPAADASEAPASEVTTAEAS
FT                   SEAASAEAAPAAKAEPELVEVWRPGGRSDEHRPRHDRNRHRNRPQHGAPAGANESESAE
FT                   AKSDRGGGRRGKGEFRRDRRDQEGEGVRREASAEGRPPRERFKGRDKFQDKHQGGKGGR
FT                   DNQGGGSHRQVHSSAPRERDRPMDPNSPFAKLAALKEQLTAGRKD"
     MPNLYSEAFT ADRVPGAGVT AVLGPTNTGK THLAIERMVA HPSGLIGLPL RLLAREVYNK        60
     IVDKVGANAV ALVTGEEKIK PSKPRYWVST VEAMPRDLDV SFLAVDEIQI AADLERGHVF       120
     TDRILRRRGR DETLLLGAAT MRPMIERLLP GASIVTRPRL SQLEYAGDRK LTRQPRRTAI       180
     VAFSADEVYA IAELIKRQHG GAAVVLGSLS PRTRNAQVAM FQSGDVDYLI ATDAIGMGLN       240
     LDVDHVAFAS DRKFDGYQFR RLTPAEFAQI GGRAGRATRD GTFGTTGRCA PFEPELVNAL       300
     QNHSFEPVKM LQWRNAELDF ASIGALQVSL AESPRHEALT RAPVAEDLRV LDHVARDAEV       360
     REIAQGKAAV ERLWDVCQVP DYRKIAPAAH AELVITLYRF LMQKGRIPDS WFAAQVDQAD       420
     RTDGGIDTLS ARIAQIRTWT FVANRPDWLA DPEHWQGISR DVENKLSDAL HERLTERFVD       480
     RRTSVLMRRL RENTMLNTEI GKTGEVIVEG HVIGRLDGFT FAPDAAEAGS DAKALQATAQ       540
     KALAGEIDAR AEKLSNAPDD QFILTSDGTI RWTGDAVARL VGSDDVLRPR LRIIADDRLA       600
     GAPREAVQTR LDLWLKTHVE KILGPLFELG KAEDVSGIAR GIAFQLIESL GVLERAKIAT       660
     EMKDLDQPSR ATLRKYGVRF GAYHIYFPSL LKPAARALAS LLWAQKQDNV DLAALSSAQH       720
     LAGSGRTSFP ADKALDRDAY RTLGYRLCGE RAVRVDILER LADLIRPALA WREGASGEKP       780
     AGAFDGRSFV VTQAMTSLTG SAGEDFASIL KALGYRMERR PAPPPAPKAA ETASPATEEA       840
     AATSDMSAED QAILAGAIAF EPSPTAEGDV AEAAPTVDEQ PAADEPAAVD QPVATAAEPA       900
     AEAAAAETAE QPAADASEAP ASEVTTAEAS SEAASAEAAP AAKAEPELVE VWRPGGRSDE       960
     HRPRHDRNRH RNRPQHGAPA GANESESAEA KSDRGGGRRG KGEFRRDRRD QEGEGVRREA      1020
     SAEGRPPRER FKGRDKFQDK HQGGKGGRDN QGGGSHRQVH SSAPRERDRP MDPNSPFAKL      1080
     AALKEQLTAG RKD                                                         1093
//

If you have problems or comments...

PBIL Back to PBIL home page