(data stored in ACNUC30630 zone)

EMBL: CP001096.PE499

CP001096.PE499       Location/Qualifiers
FT   CDS             545560..545829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0502"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: bja:bsr0185
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99061"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH5"
FT                   /protein_id="ACE99061.1"
FT                   /translation="MGTQDTITQKLREAFTPESLAVIDESNLHEGHAGHSGRSETHFRV
FT                   NIVSAAFAGKSRVDRHRMVNDLLAPELKGGVHALAIKAKAPGEA"
     MGTQDTITQK LREAFTPESL AVIDESNLHE GHAGHSGRSE THFRVNIVSA AFAGKSRVDR        60
     HRMVNDLLAP ELKGGVHALA IKAKAPGEA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page