(data stored in ACNUC30630 zone)

EMBL: CP001096.PE503

CP001096.PE503       Location/Qualifiers
FT   CDS             549153..549299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bsr0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99065"
FT                   /db_xref="GOA:B3QAH9"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH9"
FT                   /protein_id="ACE99065.1"
FT                   /translation="MPTLFRFLTVIGVVGGIIYGTIFALANFVGPNSREMTVTIGPDKF
FT                   LKK"
     MPTLFRFLTV IGVVGGIIYG TIFALANFVG PNSREMTVTI GPDKFLKK                     48
//

If you have problems or comments...

PBIL Back to PBIL home page