(data stored in ACNUC30630 zone)

EMBL: CP001096.PE506

CP001096.PE506       Location/Qualifiers
FT   CDS             551193..552143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0509"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: nwi:Nwi_0392 acetyl-CoA carboxylase
FT                   carboxyltransferase subunit alpha; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit; PFAM:
FT                   acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99068"
FT                   /db_xref="GOA:B3QBB5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB5"
FT                   /protein_id="ACE99068.1"
FT                   /translation="MRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEIEKIEEKAQQA
FT                   LQDLYAALTPWQKTQVARHPQRPHCVDYIEGLITEFTPLAGDRKFGDDEALVGGFGRFR
FT                   GEAVCVIGQEKGSTTETRLRHNFGMARPEGYRKAVRLMEMADRFDLPVLSLVDTAGAYP
FT                   GIGAEERGQAEAIARSTDACLQLGVPNVALVIGEGGSGGAIAIATANKVLMLEHAVYSV
FT                   ISPEAASSILWRDGTKAQEAANSMKITAQDLLKFGVIDQILAEPKGGAHRDPEAMIATA
FT                   GDAIAAAFAELKGQGRDAIRAKRRQKFLDIGRKLA"
     MRSYLDFEKP VAELDSKIDE LRTLAASGSD IHEEIEKIEE KAQQALQDLY AALTPWQKTQ        60
     VARHPQRPHC VDYIEGLITE FTPLAGDRKF GDDEALVGGF GRFRGEAVCV IGQEKGSTTE       120
     TRLRHNFGMA RPEGYRKAVR LMEMADRFDL PVLSLVDTAG AYPGIGAEER GQAEAIARST       180
     DACLQLGVPN VALVIGEGGS GGAIAIATAN KVLMLEHAVY SVISPEAASS ILWRDGTKAQ       240
     EAANSMKITA QDLLKFGVID QILAEPKGGA HRDPEAMIAT AGDAIAAAFA ELKGQGRDAI       300
     RAKRRQKFLD IGRKLA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page