(data stored in ACNUC30630 zone)

EMBL: CP001096.PE508

CP001096.PE508       Location/Qualifiers
FT   CDS             complement(554193..557033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0511"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SEC-C motif domain protein; SecA DEAD domain protein; SecA
FT                   Wing and Scaffold; SecA preprotein cross-linking region;
FT                   KEGG: bja:bll0204 preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99070"
FT                   /db_xref="GOA:B3QBB7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QBB7"
FT                   /protein_id="ACE99070.1"
FT                   /translation="MIGALARKLFGSANDRRVKGYQTRVAAINALEPEVAALSDEALRA
FT                   RTAEFRAELAAGKTLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLAVYLNALAGKGVHVVTVNDYLAKRDSGWMGQIYGFLGMTTGVIVHGLDD
FT                   AQRQAAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQRGHNFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSDFYNTIDTFIPRLDKSDYDVDEKQRTVTLTEAGMEKIETLLRDAGQLR
FT                   GESLYDVENVSVVHHVNQALRAHALFQRDKDYIVRNDEVVIIDEFTGRMMQGRRYSEGL
FT                   HQALEAKEHVTVQPENQTLASITFQNYFRMYDKLAGMTGTASTEADEFFDIYKLEVVEI
FT                   PTNLPIARLDEDDEVYRTQQEKYAAILAEVERANKRMQPVLVGTASIEKSEVLAEYLKK
FT                   NGYKQIDFTDPKGMDKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRIQQEAAHITDEAERAAKITEIKADIERFRDIVLKAEDEIEIE
FT                   PAKGNKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLMR
FT                   IFGSDKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDDVQNDQ
FT                   RKVIFDQRIELMKEDSVAETVTDMRHTYIEDLVAKYVPEHAYAEQWDVAGLKAEVERVV
FT                   GLDIPVDEWAKEEGIADEELITRLERVFDEHMAAKVGQWGSDVMRYAEKSILLQTLDHL
FT                   WREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFNLFQEMSSHLREAVTAQLMRVEIIP
FT                   PDQPQELPPMEVHKMDPDTGQDEMALANVTLAPAQTTDKADRDPNKPETWGKVGRNEDC
FT                   PCGSGKKYKHCHGRYA"
     MIGALARKLF GSANDRRVKG YQTRVAAINA LEPEVAALSD EALRARTAEF RAELAAGKTL        60
     DDLLVPAFAT VREAAKRTLG QRHFDVQLIG GMVLHEGDIA EMKTGEGKTL VATLAVYLNA       120
     LAGKGVHVVT VNDYLAKRDS GWMGQIYGFL GMTTGVIVHG LDDAQRQAAY ACDITYGTNN       180
     EYGFDYLRDN MKYRLEDMVQ RGHNFAIVDE VDSILIDEAR TPLIISGPLD DRSDFYNTID       240
     TFIPRLDKSD YDVDEKQRTV TLTEAGMEKI ETLLRDAGQL RGESLYDVEN VSVVHHVNQA       300
     LRAHALFQRD KDYIVRNDEV VIIDEFTGRM MQGRRYSEGL HQALEAKEHV TVQPENQTLA       360
     SITFQNYFRM YDKLAGMTGT ASTEADEFFD IYKLEVVEIP TNLPIARLDE DDEVYRTQQE       420
     KYAAILAEVE RANKRMQPVL VGTASIEKSE VLAEYLKKNG YKQIDFTDPK GMDKLYAAAR       480
     AGKPAKLFAV LNARFHEQEA YIVAEAGVPG AITIATNMAG RGTDIKLGGS LEMRIQQEAA       540
     HITDEAERAA KITEIKADIE RFRDIVLKAE DEIEIEPAKG NKPAKTAKRP GGLYIIGSER       600
     HESRRIDNQL RGRSGRQGDP GRSKFFLSLE DDLMRIFGSD KLDTMLTRLG LKEGEAIIHP       660
     WINKALEKAQ QKVEARNFDI RKNLLKFDDV QNDQRKVIFD QRIELMKEDS VAETVTDMRH       720
     TYIEDLVAKY VPEHAYAEQW DVAGLKAEVE RVVGLDIPVD EWAKEEGIAD EELITRLERV       780
     FDEHMAAKVG QWGSDVMRYA EKSILLQTLD HLWREHLVML DHLRQVIGLR GYGQRDPLQE       840
     YKSEAFNLFQ EMSSHLREAV TAQLMRVEII PPDQPQELPP MEVHKMDPDT GQDEMALANV       900
     TLAPAQTTDK ADRDPNKPET WGKVGRNEDC PCGSGKKYKH CHGRYA                      946
//

If you have problems or comments...

PBIL Back to PBIL home page