(data stored in ACNUC30630 zone)

EMBL: CP001096.PE51

CP001096.PE51        Location/Qualifiers
FT   CDS             55375..55515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98613"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y4"
FT                   /protein_id="ACE98613.1"
FT                   /translation="MITVAGLVVRRDQHYRDTAKTSRPKGVRLYSKFPIRQGVYNRSGK
FT                   A"
     MITVAGLVVR RDQHYRDTAK TSRPKGVRLY SKFPIRQGVY NRSGKA                       46
//

If you have problems or comments...

PBIL Back to PBIL home page