(data stored in ACNUC30630 zone)

EMBL: CP001096.PE510

CP001096.PE510       Location/Qualifiers
FT   CDS             complement(558419..561142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0513"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: bja:bll0924 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99072"
FT                   /db_xref="GOA:B3QBB9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB9"
FT                   /protein_id="ACE99072.1"
FT                   /translation="MTIRPDIALPPDAAPPPEAPAKMSPMMEQYHEIKAANPGLLLFYR
FT                   MGDFYELFFEDAEIASRALGITLTKRGKHLGADIPMCGVPVERSDDYLHRLIALGHRVA
FT                   VCEQTEDPAAARARKSVVRRDVVRLITPGTLTEDTLLDARANNYLLAIARARGSAGADR
FT                   IGLAWIDISTGEFCVTECTTAELAATLARINPNEAIVPDALYSDTELAPTLRELAAVTP
FT                   LTRDVFDSATAERRLCDYFAVATMDGLAALSRLEATAAAACVTYVDRTQLGKRPPLSPP
FT                   SREAAGTTMAIDPATRANLELTRTLAGERRGSLLDAIDCTVTAAGSRLLAQRLAAPLTD
FT                   AAAIARRLDAVEAFTGDAGLREQIRSSLRAAPDMARALARLSLGRGGPRDLANLRDGIR
FT                   AADEVIAQLGQLASPPQEIASAMAALQRPSRALCAELGRALADDLPLLKRDGGFVREGY
FT                   EPALDETRKLRDASRLVVASMQARYADDTGIKALKIRHNNVLGYFVEVSAQHGDKLMAP
FT                   PLNATFIHRQTLAGQVRFTTAELGEIEAKIANAGDRALGLELEIFDRLAAMIDAAGEDL
FT                   RAAAHAFALLDVATALAKLASDDNYVRPEVDESLSFAIEGGRHPVVEQALKKAGEPFIA
FT                   NACDLSPGPAQTNGQIWLLTGPNMAGKSTFLRQNALIALLAQVGSFVPAIRARIGIVDR
FT                   LFSRVGAADDLARGRSTFMVEMVETAAILNQASERALVILDEIGRGTATFDGLSIAWAA
FT                   IEHLHEQNRCRSLFATHYHELTALSAKLPRLFNATVRVKEWRGEVVFLHEVLPGSADRS
FT                   YGIQVAKLAGLPPSVVSRAKAVLAKLEANDRGQPKTLIDDLPLFAITARAPAEAAPPSE
FT                   AEQLIDAVKALHPDEMTPREALDALYALKAKLPKAD"
     MTIRPDIALP PDAAPPPEAP AKMSPMMEQY HEIKAANPGL LLFYRMGDFY ELFFEDAEIA        60
     SRALGITLTK RGKHLGADIP MCGVPVERSD DYLHRLIALG HRVAVCEQTE DPAAARARKS       120
     VVRRDVVRLI TPGTLTEDTL LDARANNYLL AIARARGSAG ADRIGLAWID ISTGEFCVTE       180
     CTTAELAATL ARINPNEAIV PDALYSDTEL APTLRELAAV TPLTRDVFDS ATAERRLCDY       240
     FAVATMDGLA ALSRLEATAA AACVTYVDRT QLGKRPPLSP PSREAAGTTM AIDPATRANL       300
     ELTRTLAGER RGSLLDAIDC TVTAAGSRLL AQRLAAPLTD AAAIARRLDA VEAFTGDAGL       360
     REQIRSSLRA APDMARALAR LSLGRGGPRD LANLRDGIRA ADEVIAQLGQ LASPPQEIAS       420
     AMAALQRPSR ALCAELGRAL ADDLPLLKRD GGFVREGYEP ALDETRKLRD ASRLVVASMQ       480
     ARYADDTGIK ALKIRHNNVL GYFVEVSAQH GDKLMAPPLN ATFIHRQTLA GQVRFTTAEL       540
     GEIEAKIANA GDRALGLELE IFDRLAAMID AAGEDLRAAA HAFALLDVAT ALAKLASDDN       600
     YVRPEVDESL SFAIEGGRHP VVEQALKKAG EPFIANACDL SPGPAQTNGQ IWLLTGPNMA       660
     GKSTFLRQNA LIALLAQVGS FVPAIRARIG IVDRLFSRVG AADDLARGRS TFMVEMVETA       720
     AILNQASERA LVILDEIGRG TATFDGLSIA WAAIEHLHEQ NRCRSLFATH YHELTALSAK       780
     LPRLFNATVR VKEWRGEVVF LHEVLPGSAD RSYGIQVAKL AGLPPSVVSR AKAVLAKLEA       840
     NDRGQPKTLI DDLPLFAITA RAPAEAAPPS EAEQLIDAVK ALHPDEMTPR EALDALYALK       900
     AKLPKAD                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page