(data stored in ACNUC30630 zone)

EMBL: CP001096.PE521

CP001096.PE521       Location/Qualifiers
FT   CDS             complement(573263..573949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0524"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   nha:Nham_0622 protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99083"
FT                   /db_xref="GOA:B3QBD0"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD0"
FT                   /protein_id="ACE99083.1"
FT                   /translation="MTEHPDDDPLLLRFRKLPRIVRLVYSRPRLFASIAIGVVAFALLP
FT                   GWLRPVTRALIGWDVSIIVYLALAYTMMARCGVAYIRRNAVLQDDGRFLILMVTAIGAY
FT                   ATIAAIVTELGTAHRGAAELALATFTIALSWAAVHTTFALHYAHEYYRGDREGGLAFPG
FT                   SDEHTEPDYWDFVYFSFVIGMTAQVSDVGITDRTIRRTATAHGVVSFVFNTALVALMVN
FT                   IAASAI"
     MTEHPDDDPL LLRFRKLPRI VRLVYSRPRL FASIAIGVVA FALLPGWLRP VTRALIGWDV        60
     SIIVYLALAY TMMARCGVAY IRRNAVLQDD GRFLILMVTA IGAYATIAAI VTELGTAHRG       120
     AAELALATFT IALSWAAVHT TFALHYAHEY YRGDREGGLA FPGSDEHTEP DYWDFVYFSF       180
     VIGMTAQVSD VGITDRTIRR TATAHGVVSF VFNTALVALM VNIAASAI                    228
//

If you have problems or comments...

PBIL Back to PBIL home page