(data stored in ACNUC30630 zone)

EMBL: CP001096.PE528

CP001096.PE528       Location/Qualifiers
FT   CDS             complement(579348..579938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0531"
FT                   /product="polyhydroxyalkonate synthesis repressor, PhaR"
FT                   /note="TIGRFAM: polyhydroxyalkanoate synthesis repressor
FT                   PhaR; PFAM: PHB accumulation regulatory domain protein; PHA
FT                   accumulation regulator DNA-binding protein; KEGG:
FT                   bbt:BBta_7615 putative polyhydroxyalkanoate synthesis
FT                   repressor PhaR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99090"
FT                   /db_xref="GOA:B3QBD7"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD7"
FT                   /protein_id="ACE99090.1"
FT                   /translation="MAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLATMVKDGEDFLVY
FT                   DAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLEQSIDS
FT                   LTREQEKFRKQMASTFSLTPFAPLEETVRRNMELFQQTFSMFVPRPPSHESTDEVPAET
FT                   SGGADSIEDLRRQMKEMQERLERMSLEQPKKDE"
     MAKSDQPTTI KKYANRRLYN TGTSTYVTLE DLATMVKDGE DFLVYDAKTG DDITRSVLAQ        60
     IIFEQENKAG QNLLPTTFLR QLIRFYGDSM QMVVPKYLEQ SIDSLTREQE KFRKQMASTF       120
     SLTPFAPLEE TVRRNMELFQ QTFSMFVPRP PSHESTDEVP AETSGGADSI EDLRRQMKEM       180
     QERLERMSLE QPKKDE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page