(data stored in ACNUC30630 zone)

EMBL: CP001096.PE532

CP001096.PE532       Location/Qualifiers
FT   CDS             complement(583269..583790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0535"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide; putative protease"
FT                   /note="KEGG: bra:BRADO0756 conserved hypothetical protein;
FT                   putative signal peptide; putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99094"
FT                   /db_xref="GOA:B3QBE1"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE1"
FT                   /protein_id="ACE99094.1"
FT                   /translation="MRSIMIFAAALVVLGTAMAQIADRITPAPAQAHAAPHGTIGTAAA
FT                   TPETYGRSISIDRDPRGHFRTDGRIDGQRLSFMVDTGASVVALNESSAARFGLRPSRGD
FT                   YTAKVSTANGQVKAARARIAMLDVGGLIVRDVDALVLPDEALSENLLGLSYLSKLKRFA
FT                   YADGRMVLEQ"
     MRSIMIFAAA LVVLGTAMAQ IADRITPAPA QAHAAPHGTI GTAAATPETY GRSISIDRDP        60
     RGHFRTDGRI DGQRLSFMVD TGASVVALNE SSAARFGLRP SRGDYTAKVS TANGQVKAAR       120
     ARIAMLDVGG LIVRDVDALV LPDEALSENL LGLSYLSKLK RFAYADGRMV LEQ              173
//

If you have problems or comments...

PBIL Back to PBIL home page