(data stored in ACNUC30630 zone)

EMBL: CP001096.PE561

CP001096.PE561       Location/Qualifiers
FT   CDS             complement(613311..614675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0564"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bja:bll0816
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99123"
FT                   /db_xref="GOA:B3QBH0"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH0"
FT                   /protein_id="ACE99123.1"
FT                   /translation="MANETATLAGYVAALQFTDIPQDVLARAKLLTLDFLGSAIRARRE
FT                   AESTPSILQMLQALSLDGAGESTVFGDDKRWTPAVAALLNGALGHSLDFDDTHADSSLH
FT                   PSAPVVPAAFAVGELVGASGRDVLTAIVAGYEVCCRLGNALDPTSHYARGFHPTATAGT
FT                   YGAAAAAAKLFGLSQDQIVAAFGVSGSQAAGSLQFLVNGAWNKRYQVGAAAMNGVIAAT
FT                   LAKNGFIGSTESVEGIHGLLVGYTDTPHPDKAVADLGSVYETMKIGVKPYPSCRYTHAA
FT                   IDALIAMRREHNLTPAQITRVEVGLHKNGITLTGDAPTKRHPRSIVGGQFSMFFTGALA
FT                   LEQGSFGWDDYTRLGDPAIDALADKFDVVRDERLEGKTHPFGARVSITTEDGVHERIYA
FT                   DPSGEPSSFPSDQAMTQKFLQLARPVLDGRAQSFADAVLTLERFAKVSEATALGR"
     MANETATLAG YVAALQFTDI PQDVLARAKL LTLDFLGSAI RARREAESTP SILQMLQALS        60
     LDGAGESTVF GDDKRWTPAV AALLNGALGH SLDFDDTHAD SSLHPSAPVV PAAFAVGELV       120
     GASGRDVLTA IVAGYEVCCR LGNALDPTSH YARGFHPTAT AGTYGAAAAA AKLFGLSQDQ       180
     IVAAFGVSGS QAAGSLQFLV NGAWNKRYQV GAAAMNGVIA ATLAKNGFIG STESVEGIHG       240
     LLVGYTDTPH PDKAVADLGS VYETMKIGVK PYPSCRYTHA AIDALIAMRR EHNLTPAQIT       300
     RVEVGLHKNG ITLTGDAPTK RHPRSIVGGQ FSMFFTGALA LEQGSFGWDD YTRLGDPAID       360
     ALADKFDVVR DERLEGKTHP FGARVSITTE DGVHERIYAD PSGEPSSFPS DQAMTQKFLQ       420
     LARPVLDGRA QSFADAVLTL ERFAKVSEAT ALGR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page