(data stored in ACNUC30630 zone)

EMBL: CP001096.PE569

CP001096.PE569       Location/Qualifiers
FT   CDS             complement(621032..622150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0572"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   hch:HCH_00942 protein containing VWFA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99131"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH8"
FT                   /protein_id="ACE99131.1"
FT                   /translation="MKRITFQTALTLAALALPLSFATAAQARPSVEVAFVLDTTGSMSG
FT                   LIEGAKRKIWSIATTILDDNPDADIRMGLVAYRDIGDDYVVRSVDLTTDIQDLYGQLLQ
FT                   LQARGGGDWPESVNEALDTAINKLHWRQGGDTRRIVFLVGDAPPHMDYAQDTKYPETLA
FT                   VARQKDIIVNAVQAGDARDTARVWHEIADGGRGRYIPIPQDGGQIVVIQTPYDDDIIIL
FT                   QKQINGTVIPYGPAPMQRRTEEKTGQLAKVAASAPASASDMASYINKRARSSSEAVTGG
FT                   GDLVSDVQAGRQKLDQVKEEDLPPELRALPAEQRAAKLDAQMTARKALNDKLAALVKQR
FT                   DAYLLAQRDKQPKQASSFDREVEATLKAQLKR"
     MKRITFQTAL TLAALALPLS FATAAQARPS VEVAFVLDTT GSMSGLIEGA KRKIWSIATT        60
     ILDDNPDADI RMGLVAYRDI GDDYVVRSVD LTTDIQDLYG QLLQLQARGG GDWPESVNEA       120
     LDTAINKLHW RQGGDTRRIV FLVGDAPPHM DYAQDTKYPE TLAVARQKDI IVNAVQAGDA       180
     RDTARVWHEI ADGGRGRYIP IPQDGGQIVV IQTPYDDDII ILQKQINGTV IPYGPAPMQR       240
     RTEEKTGQLA KVAASAPASA SDMASYINKR ARSSSEAVTG GGDLVSDVQA GRQKLDQVKE       300
     EDLPPELRAL PAEQRAAKLD AQMTARKALN DKLAALVKQR DAYLLAQRDK QPKQASSFDR       360
     EVEATLKAQL KR                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page