(data stored in ACNUC30630 zone)

EMBL: CP001096.PE574

CP001096.PE574       Location/Qualifiers
FT   CDS             625793..626623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0577"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bbt:BBta_7657
FT                   putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99136"
FT                   /db_xref="GOA:B3QBI3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI3"
FT                   /protein_id="ACE99136.1"
FT                   /translation="MRSLVANLELGHGLAWHRISAMVLRYWYLLLSSWPRLFELVYWPA
FT                   LQVITWGFLQSYVAQNAGFFARAGGTLIGAVILWDILFRGQLGFSISFLEEMWARNLGN
FT                   LMMSPLKPLEFLIALMIMSLIRLAIGVVPMVVLAMTLFDFNLFGFGLPLGAFFCNLIFT
FT                   SWALGIFVSGLVLRHGLGAESIVWSLMFGVMPLACVYYPVAVLPHWLQFVAWTLPPTYV
FT                   FEGMRALLIDHQFRGDLMLWALGINVVLFVAAFISFLAMLNSARRHGSLIQSGE"
     MRSLVANLEL GHGLAWHRIS AMVLRYWYLL LSSWPRLFEL VYWPALQVIT WGFLQSYVAQ        60
     NAGFFARAGG TLIGAVILWD ILFRGQLGFS ISFLEEMWAR NLGNLMMSPL KPLEFLIALM       120
     IMSLIRLAIG VVPMVVLAMT LFDFNLFGFG LPLGAFFCNL IFTSWALGIF VSGLVLRHGL       180
     GAESIVWSLM FGVMPLACVY YPVAVLPHWL QFVAWTLPPT YVFEGMRALL IDHQFRGDLM       240
     LWALGINVVL FVAAFISFLA MLNSARRHGS LIQSGE                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page