(data stored in ACNUC30630 zone)

EMBL: CP001096.PE575

CP001096.PE575       Location/Qualifiers
FT   CDS             626762..628090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0578"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /note="TIGRFAM: polyhydroxyalkanoate depolymerase,
FT                   intracellular; PFAM: PHB de-polymerase domain protein;
FT                   KEGG: bja:blr0908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99137"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI4"
FT                   /protein_id="ACE99137.1"
FT                   /translation="MPVVIGEFGRPPDMPAEVSPALTTPMYWFYEMAHASLNPARAMSD
FT                   ATKLAFKNPLNPWSHTEFGKSIAAACEVFERTTRRYGKPEWGLDDTEVNGMRVPIEIHN
FT                   VWEKPFCRLLYFERKLERPLRHPQPRLLIVAPMSGHYATLLRGTVEAFLPTHEVYITDW
FT                   ADARMVPMAAGRFDLDDYVDYVIEMLQTLGGNVHVMAVCQPSVPVLTAVSVMEANEDPF
FT                   VPLSMTLMGGPIDTRRSPTAVNNLAAEKGIDWFRNHVITKVPFPHPGFMRDVYPGFLQL
FT                   NGFISMNLDRHMDAHRNLFNHLVQGDGDLADKHREFYDEYLAVMDLTAEFYLQTVDLVF
FT                   VKHALPKGEMTHRGKLVEPSKVKRVALMTVEGENDDISGLGQTEATHGLCSSIPDNRRV
FT                   HYVQKGVGHYGVFNGSRFRSEIVPRICDFHASSTSDTSARAAE"
     MPVVIGEFGR PPDMPAEVSP ALTTPMYWFY EMAHASLNPA RAMSDATKLA FKNPLNPWSH        60
     TEFGKSIAAA CEVFERTTRR YGKPEWGLDD TEVNGMRVPI EIHNVWEKPF CRLLYFERKL       120
     ERPLRHPQPR LLIVAPMSGH YATLLRGTVE AFLPTHEVYI TDWADARMVP MAAGRFDLDD       180
     YVDYVIEMLQ TLGGNVHVMA VCQPSVPVLT AVSVMEANED PFVPLSMTLM GGPIDTRRSP       240
     TAVNNLAAEK GIDWFRNHVI TKVPFPHPGF MRDVYPGFLQ LNGFISMNLD RHMDAHRNLF       300
     NHLVQGDGDL ADKHREFYDE YLAVMDLTAE FYLQTVDLVF VKHALPKGEM THRGKLVEPS       360
     KVKRVALMTV EGENDDISGL GQTEATHGLC SSIPDNRRVH YVQKGVGHYG VFNGSRFRSE       420
     IVPRICDFHA SSTSDTSARA AE                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page