(data stored in ACNUC30630 zone)

EMBL: CP001096.PE576

CP001096.PE576       Location/Qualifiers
FT   CDS             628431..629180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0579"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   bja:blr0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99138"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI5"
FT                   /protein_id="ACE99138.1"
FT                   /translation="MARALLYRRPTEPSTIPVRHGSQFFAVRIRRHRRARRYTLRIHPS
FT                   DREAILTMPPRGTLADAKEFAQRHGAWIAARLGRLPKAAPFLPGTLVPLRGHDHKIVHR
FT                   TGRGTVWTEVRESGEKILCVAGETEHIERRVLDFLKREARKDLQKACDRYAPELGVKVT
FT                   RLSIRDQSSRWGSCTSAGSLSFSWRLILAPSYVLDYLAAHEVAHLVEMNHSARFWRVVG
FT                   KVCPQMERAKTWLDSYGNDLHRYGISD"
     MARALLYRRP TEPSTIPVRH GSQFFAVRIR RHRRARRYTL RIHPSDREAI LTMPPRGTLA        60
     DAKEFAQRHG AWIAARLGRL PKAAPFLPGT LVPLRGHDHK IVHRTGRGTV WTEVRESGEK       120
     ILCVAGETEH IERRVLDFLK REARKDLQKA CDRYAPELGV KVTRLSIRDQ SSRWGSCTSA       180
     GSLSFSWRLI LAPSYVLDYL AAHEVAHLVE MNHSARFWRV VGKVCPQMER AKTWLDSYGN       240
     DLHRYGISD                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page