(data stored in ACNUC30630 zone)

EMBL: CP001096.PE579

CP001096.PE579       Location/Qualifiers
FT   CDS             complement(632202..632414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99141"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI8"
FT                   /protein_id="ACE99141.1"
FT                   /translation="MRADSTSNRYFTVEQLEELAVAKYIEAALTPAGEERDELLEEAKR
FT                   FASRAKMKSWLMGEIGATPRRRNYH"
     MRADSTSNRY FTVEQLEELA VAKYIEAALT PAGEERDELL EEAKRFASRA KMKSWLMGEI        60
     GATPRRRNYH                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page