(data stored in ACNUC30630 zone)

EMBL: CP001096.PE65

CP001096.PE65        Location/Qualifiers
FT   CDS             complement(68564..69238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0065"
FT                   /product="protein of unknown function DUF374"
FT                   /note="PFAM: protein of unknown function DUF374; KEGG:
FT                   mag:amb4091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98627"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z8"
FT                   /protein_id="ACE98627.1"
FT                   /translation="MATPAFVKRITRSDAVLSLGVNFSKIYFKFVMWTGRYDRQAVPIP
FT                   EPYILAMWHGRLIMAPMLQTKSKPLVALISGHRDGKIISRVGAAFGIQTAVGSSSKGGM
FT                   RAAREMMRLGKSGHSLFVTPDGPRGPRMRINSEGVLDLARLTGLPILPVSVSLSRHKLL
FT                   RSWDRLMLPGLFAKVAIRFGEPITVEAGSPTAEMAERLQAALTAAQNETDRIVGLQPVE
FT                   VA"
     MATPAFVKRI TRSDAVLSLG VNFSKIYFKF VMWTGRYDRQ AVPIPEPYIL AMWHGRLIMA        60
     PMLQTKSKPL VALISGHRDG KIISRVGAAF GIQTAVGSSS KGGMRAAREM MRLGKSGHSL       120
     FVTPDGPRGP RMRINSEGVL DLARLTGLPI LPVSVSLSRH KLLRSWDRLM LPGLFAKVAI       180
     RFGEPITVEA GSPTAEMAER LQAALTAAQN ETDRIVGLQP VEVA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page