(data stored in ACNUC30630 zone)

EMBL: CP001096.PE67

CP001096.PE67        Location/Qualifiers
FT   CDS             70342..72039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0067"
FT                   /product="ribosomal protein S1"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: nha:Nham_0163 30S ribosomal protein
FT                   S1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98629"
FT                   /db_xref="GOA:B3Q600"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q600"
FT                   /protein_id="ACE98629.1"
FT                   /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGKVVAIEKDMA
FT                   VIDVGLKTEGRVPLREFAGPGRDNEIKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFQNNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVEVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKHPVGSTVEGEVKNKTEFGLFLGLDGDVDGM
FT                   VHLSDLDWKLPGEQVIDNFKKGDMVKAVVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAVVTCEVLDVKESGIDVQIVGTDFNTFIKRSELARDRNDQRSDRFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
     MASTDTYNPT RDDFAAMLDE SFAGGNLQES SVIKGKVVAI EKDMAVIDVG LKTEGRVPLR        60
     EFAGPGRDNE IKVGDTVEVF LDRIENALGE AVLSRDKARR EESWGKLEKA FQNNEKVFGV       120
     IFNQVKGGFT VDLDGAVAFL PRSQVDIRPI RDVAPLMNNS QPFQILKMDR RRGNIVVSRR       180
     TVLEETRAEQ RQELVQNLEE GQVIDGVVKN ITDYGAFVDL GGIDGLLHVT DIAWRRVNHP       240
     TEVLTIGQTV KVKIIKINHE THRISLGMKQ LLDDPWQGIE AKYPLNARFT GRVTNITDYG       300
     AFVELEPGIE GLIHVSEMSW TKKNMHPGKI VSTSQEVEVQ VLEVDSVKRR ISLGLKQTMR       360
     NPWEVFVEKH PVGSTVEGEV KNKTEFGLFL GLDGDVDGMV HLSDLDWKLP GEQVIDNFKK       420
     GDMVKAVVLD VDVEKERISL GVKQLEGDPF AEPGDVKKGA VVTCEVLDVK ESGIDVQIVG       480
     TDFNTFIKRS ELARDRNDQR SDRFAVGEKV DARVIQFDKK ARKVQVSIKA LEVAEEKEAI       540
     AQYGSSDSGA TLGDILGTAL KQRDK                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page