(data stored in ACNUC30630 zone)

EMBL: CP001096.PE73

CP001096.PE73        Location/Qualifiers
FT   CDS             76080..76916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0073"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: bbt:BBta_0096 tryptophan synthase subunit
FT                   alpha; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98635"
FT                   /db_xref="GOA:B3Q606"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q606"
FT                   /protein_id="ACE98635.1"
FT                   /translation="MTTRIDTRFADLKQQGRPALVTFVMAGDPDLDTSLQILKALPAAG
FT                   ADVIEIGMPFTDPMADGPAIQAAGLRALKAGTTLKKTLGLVRDFRATDNATPLVLMGYY
FT                   NPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDEKR
FT                   LPAVLANTSGFVYYVSITGITGSASADASAVGAAVQRIKRHTNLPVCVGFGIRTPDAAQ
FT                   AIAAQANGAVVGSALIDALKASLDAEGRATKGTVGAVADLVASLAAGVRGAKQAAE"
     MTTRIDTRFA DLKQQGRPAL VTFVMAGDPD LDTSLQILKA LPAAGADVIE IGMPFTDPMA        60
     DGPAIQAAGL RALKAGTTLK KTLGLVRDFR ATDNATPLVL MGYYNPIYIY GVDAFLADAK       120
     AAGVDGLIIV DLPPEEDEEL CLPAMKAGLN FIRLATPTTD EKRLPAVLAN TSGFVYYVSI       180
     TGITGSASAD ASAVGAAVQR IKRHTNLPVC VGFGIRTPDA AQAIAAQANG AVVGSALIDA       240
     LKASLDAEGR ATKGTVGAVA DLVASLAAGV RGAKQAAE                               278
//

If you have problems or comments...

PBIL Back to PBIL home page