(data stored in ACNUC30630 zone)

EMBL: CP001096.PE81

CP001096.PE81        Location/Qualifiers
FT   CDS             complement(87924..89444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0081"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: aminoglycoside phosphotransferase; protein of
FT                   unknown function UPF0079; KEGG: nha:Nham_0054 protein of
FT                   unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98643"
FT                   /db_xref="GOA:B3Q614"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q614"
FT                   /protein_id="ACE98643.1"
FT                   /translation="MSAVATFSVALANEVATVRLMAEVALLIGPGDVVTLSGDLGAGKT
FT                   AAARAMIRYLADDDALEVPSPTFTLVQTYDLPPYPLLHADLYRVEDPSELEEIGLSPLP
FT                   DGTVALIEWPERAGAALPEDRIDIALSHRPALGPSARAAEITGHGKAVKQVERLAALRS
FT                   FIETAGYADAERRHMPGDASTRSYARLQRGAESVILMNAPRRPDGPALYAGKSYSAAVH
FT                   LAEDVRPFVAIGQGLRERGFSAPAIHHADLDAGFLITEDLGRIGFVEGDPPAPVVARYQ
FT                   AATDMLAALHAKPLPDHLPLSTRESYAVPTFDEAAMMIEVGLMPEWYLPDRGAPPSEAL
FT                   RAEFVALWRKLLAGIATAPRTWVLRDYHSPNLIWLEDRPGIERVGVIDFQDTVLGPAAY
FT                   DVVSLLQDARIDVPEATELSLLGRYVKARLAADPEFDAPGFARLYAVMSAQRNTRLLGT
FT                   FARLNRRDGKPQYLKHQPRVWAYLARSLAHPALAEVRAWYRDHVPPPL"
     MSAVATFSVA LANEVATVRL MAEVALLIGP GDVVTLSGDL GAGKTAAARA MIRYLADDDA        60
     LEVPSPTFTL VQTYDLPPYP LLHADLYRVE DPSELEEIGL SPLPDGTVAL IEWPERAGAA       120
     LPEDRIDIAL SHRPALGPSA RAAEITGHGK AVKQVERLAA LRSFIETAGY ADAERRHMPG       180
     DASTRSYARL QRGAESVILM NAPRRPDGPA LYAGKSYSAA VHLAEDVRPF VAIGQGLRER       240
     GFSAPAIHHA DLDAGFLITE DLGRIGFVEG DPPAPVVARY QAATDMLAAL HAKPLPDHLP       300
     LSTRESYAVP TFDEAAMMIE VGLMPEWYLP DRGAPPSEAL RAEFVALWRK LLAGIATAPR       360
     TWVLRDYHSP NLIWLEDRPG IERVGVIDFQ DTVLGPAAYD VVSLLQDARI DVPEATELSL       420
     LGRYVKARLA ADPEFDAPGF ARLYAVMSAQ RNTRLLGTFA RLNRRDGKPQ YLKHQPRVWA       480
     YLARSLAHPA LAEVRAWYRD HVPPPL                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page