(data stored in ACNUC30630 zone)

EMBL: CP001096.PE89

CP001096.PE89        Location/Qualifiers
FT   CDS             99189..99989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0089"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bja:blr0765 molybdopterin
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98651"
FT                   /db_xref="GOA:B3Q622"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q622"
FT                   /protein_id="ACE98651.1"
FT                   /translation="MLSAEELERYARHIVLRDVGGPGQAALKGARVLVVGAGGLGAPVL
FT                   MYLAAAGIGTLDIVDDDIVTLSNLQRQVIHATPDIGARKADSAASRILALNPHVRVVQH
FT                   RVRLDGSNALTLIGGCDLVLDGSDNFATRYLVSDACYLAKKPLITAALGQFDGSLTTIR
FT                   AHECNAAGEPNPTYRCLFPEPPPAGTVPSCEEAGVMGALAGVLGSMMALEAIREIVGFG
FT                   EGLVGRLVMIDARAMRFETLRYSRDPQNPLNGDAPTITDLSRHL"
     MLSAEELERY ARHIVLRDVG GPGQAALKGA RVLVVGAGGL GAPVLMYLAA AGIGTLDIVD        60
     DDIVTLSNLQ RQVIHATPDI GARKADSAAS RILALNPHVR VVQHRVRLDG SNALTLIGGC       120
     DLVLDGSDNF ATRYLVSDAC YLAKKPLITA ALGQFDGSLT TIRAHECNAA GEPNPTYRCL       180
     FPEPPPAGTV PSCEEAGVMG ALAGVLGSMM ALEAIREIVG FGEGLVGRLV MIDARAMRFE       240
     TLRYSRDPQN PLNGDAPTIT DLSRHL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page