(data stored in ACNUC30630 zone)

EMBL: CP001096.PE90

CP001096.PE90        Location/Qualifiers
FT   CDS             100114..101802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0090"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: bja:blr0559 MFS
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98652"
FT                   /db_xref="GOA:B3Q623"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q623"
FT                   /protein_id="ACE98652.1"
FT                   /translation="MAGTAKRGLFSGDGIAAPLRHALFRRIWLASLLSNLGLMINGVGA
FT                   AWAMTQMTASADKVALVQTALMLPIMLVAMPAGAIADMYDRRLVALAALGIGLAGATTL
FT                   AALAHLGLVTPNTLLLFCFVIGTGMALFGPSWQASVSEQVPAETLPAAVALNGISYNIA
FT                   RSFGPAVGGIVVAAAGAVAAFAANAVLYLPLLIVLLLWRRDSEPPRLPPERLNRAIVSG
FT                   VRYITNSPAIRIVLTRTLVTGIAGSSVLALMPLVARDLLHSGAETYGLLLGAFGIGAVI
FT                   GALNVGIARQRLSSEAAVRLCAMIMGVAMAVIAISRSPLLTAAALVVAGAVWMLAIALF
FT                   NIGVQLSAPRWVAGRSLAAFQASISGGIAIGSWGWGHVADLSGVAPSMLLSGLAMLASP
FT                   VLAFLLPMPPVGTRTEDAELLADPELKLALTSRSGPVVIEIEYRIDADEARAFHNVMQE
FT                   VQLSRQRNGAYGWSIARDVADPELWTERYHCPTWLDYLRQRSRSTQDDRALHRRAIAFH
FT                   RGPEPVRVRRMLERPFGSVRWKEESPDRTTATEVLPVAGVSGGST"
     MAGTAKRGLF SGDGIAAPLR HALFRRIWLA SLLSNLGLMI NGVGAAWAMT QMTASADKVA        60
     LVQTALMLPI MLVAMPAGAI ADMYDRRLVA LAALGIGLAG ATTLAALAHL GLVTPNTLLL       120
     FCFVIGTGMA LFGPSWQASV SEQVPAETLP AAVALNGISY NIARSFGPAV GGIVVAAAGA       180
     VAAFAANAVL YLPLLIVLLL WRRDSEPPRL PPERLNRAIV SGVRYITNSP AIRIVLTRTL       240
     VTGIAGSSVL ALMPLVARDL LHSGAETYGL LLGAFGIGAV IGALNVGIAR QRLSSEAAVR       300
     LCAMIMGVAM AVIAISRSPL LTAAALVVAG AVWMLAIALF NIGVQLSAPR WVAGRSLAAF       360
     QASISGGIAI GSWGWGHVAD LSGVAPSMLL SGLAMLASPV LAFLLPMPPV GTRTEDAELL       420
     ADPELKLALT SRSGPVVIEI EYRIDADEAR AFHNVMQEVQ LSRQRNGAYG WSIARDVADP       480
     ELWTERYHCP TWLDYLRQRS RSTQDDRALH RRAIAFHRGP EPVRVRRMLE RPFGSVRWKE       540
     ESPDRTTATE VLPVAGVSGG ST                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page