(data stored in ACNUC30630 zone)

EMBL: CP001096.PE93

CP001096.PE93        Location/Qualifiers
FT   CDS             complement(102281..102622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98655"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q626"
FT                   /protein_id="ACE98655.1"
FT                   /translation="MADKNSSDVILNVMTKNLEQARGAMTNYLEFISKSMSVVPMGQSS
FT                   QATTLKGYVDRNVQATFDFSQQLLHAKDFQDVVRIQTEFLQTQFRVLTDQAKDVVEMTK
FT                   PTVIVPNDG"
     MADKNSSDVI LNVMTKNLEQ ARGAMTNYLE FISKSMSVVP MGQSSQATTL KGYVDRNVQA        60
     TFDFSQQLLH AKDFQDVVRI QTEFLQTQFR VLTDQAKDVV EMTKPTVIVP NDG              113
//

If you have problems or comments...

PBIL Back to PBIL home page