(data stored in ACNUC7421 zone)

EMBL: CP001111.PE1

CP001111.PE1         Location/Qualifiers
FT   CDS             215..1546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: xac:XAC0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49706"
FT                   /db_xref="GOA:B4SU11"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SU11"
FT                   /protein_id="ACF49706.1"
FT                   /translation="MDAWSRSLERLEAEFPPEDVHTWLKPLQADLRVDSLVLYAPNAFI
FT                   VDQVRELYLARIRELLAHFAGFSDVFLEIGSRPRPVEAQNAPFSTPSAHVSSEPQVPFA
FT                   GNLDNHYTFANFVEGRSNQLGLAAAFQAAQKPGDRAHNPLLLYGGTGLGKTHLMFAAGN
FT                   AMRQANPGAKVLYLRSEQFFSAMIRALQEKTMDQFKRQFQQVDALLIDDIQFFAGKDRT
FT                   QEEFFHTFNALFDGKQQIILTCDRYPREVEGLEARLKSRLAWGLSVAIEPPDFETRAAI
FT                   VLAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLTARANFTGRAITTEFAQETLR
FT                   DLLRAQQQAISIPNIQKTVADYYGLQIKDLLSKRRTRSLARPRQVAMALTKELTEHSLP
FT                   EIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWDKLIRKLSE"
     MDAWSRSLER LEAEFPPEDV HTWLKPLQAD LRVDSLVLYA PNAFIVDQVR ELYLARIREL        60
     LAHFAGFSDV FLEIGSRPRP VEAQNAPFST PSAHVSSEPQ VPFAGNLDNH YTFANFVEGR       120
     SNQLGLAAAF QAAQKPGDRA HNPLLLYGGT GLGKTHLMFA AGNAMRQANP GAKVLYLRSE       180
     QFFSAMIRAL QEKTMDQFKR QFQQVDALLI DDIQFFAGKD RTQEEFFHTF NALFDGKQQI       240
     ILTCDRYPRE VEGLEARLKS RLAWGLSVAI EPPDFETRAA IVLAKARERG AEIPDDVAFL       300
     IAKKMRSNVR DLEGALNTLT ARANFTGRAI TTEFAQETLR DLLRAQQQAI SIPNIQKTVA       360
     DYYGLQIKDL LSKRRTRSLA RPRQVAMALT KELTEHSLPE IGDAFAGRDH TTVLHACRQI       420
     RTLMEADGKL REDWDKLIRK LSE                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page