(data stored in ACNUC7421 zone)

EMBL: CP001111.PE105

CP001111.PE105       Location/Qualifiers
FT   CDS             127732..129801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0105"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   xac:XAC0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU0"
FT                   /protein_id="ACF49810.1"
FT                   /translation="MQDQIIQALRQNQADQAVQLAQAWTRDEPGLAEAHRWLALALQQQ
FT                   GNAEHAMDALQEALRLAPDDAQLHLQQAGLLLALRQFEGADEALARTTGLDPNSFSAYL
FT                   MQAHLAIGRNDFDEAARVSTLASRVEPDHPELLTIDGMVALRRGDADRALSLLSAASKA
FT                   LPDDPRVLYALGFAYLGKDMLAFAEQSFRRVLELNPSLSSLHGLVVQLALRQGNVPAAA
FT                   EAMQVALQQPQMDVPAMRRLAGELSLRSGQPLQALEYLLPLLETQPDDRQMLQLLLMSW
FT                   QRLGREDEARARLDAVLENNDQLHDVWLARLAIEQVGSESAVTAVERWMAAMPEHLPAL
FT                   EARLRLHDMAGEHAQAEAIAERIVSQEPGRVSGETRLVEGLLQRDPAAAVARVQALIDL
FT                   APEGHRADLRTWMGEIQDRAAQPQEALRTWMALQADQAPQRLPLPPQAKAPPSWPDKGD
FT                   IDGDATSAPIFLWGAPGSGVERVATGLAAASPVLRSDRYTNTPPDDAFQNYHTLQDLAS
FT                   GVLTPERLVERWREQLPARGLQNDTVIDWLLWWDNALLWALRPQLPQGRLLLVLRDPRD
FT                   MLLDWVAYGAAAPLAMTSLAEAGEWLARALTQVATLHEEDLYPHVLLRIDHIGNDPQAM
FT                   AELLGRLFERPMPPAAQLGAPRLPPGHWRNYRDVMSAAFALLTPIAVRLGYPEE"
     MQDQIIQALR QNQADQAVQL AQAWTRDEPG LAEAHRWLAL ALQQQGNAEH AMDALQEALR        60
     LAPDDAQLHL QQAGLLLALR QFEGADEALA RTTGLDPNSF SAYLMQAHLA IGRNDFDEAA       120
     RVSTLASRVE PDHPELLTID GMVALRRGDA DRALSLLSAA SKALPDDPRV LYALGFAYLG       180
     KDMLAFAEQS FRRVLELNPS LSSLHGLVVQ LALRQGNVPA AAEAMQVALQ QPQMDVPAMR       240
     RLAGELSLRS GQPLQALEYL LPLLETQPDD RQMLQLLLMS WQRLGREDEA RARLDAVLEN       300
     NDQLHDVWLA RLAIEQVGSE SAVTAVERWM AAMPEHLPAL EARLRLHDMA GEHAQAEAIA       360
     ERIVSQEPGR VSGETRLVEG LLQRDPAAAV ARVQALIDLA PEGHRADLRT WMGEIQDRAA       420
     QPQEALRTWM ALQADQAPQR LPLPPQAKAP PSWPDKGDID GDATSAPIFL WGAPGSGVER       480
     VATGLAAASP VLRSDRYTNT PPDDAFQNYH TLQDLASGVL TPERLVERWR EQLPARGLQN       540
     DTVIDWLLWW DNALLWALRP QLPQGRLLLV LRDPRDMLLD WVAYGAAAPL AMTSLAEAGE       600
     WLARALTQVA TLHEEDLYPH VLLRIDHIGN DPQAMAELLG RLFERPMPPA AQLGAPRLPP       660
     GHWRNYRDVM SAAFALLTPI AVRLGYPEE                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page