(data stored in ACNUC7421 zone)

EMBL: CP001111.PE107

CP001111.PE107       Location/Qualifiers
FT   CDS             complement(130556..131383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0107"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: pen:PSEEN3175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49812"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU2"
FT                   /protein_id="ACF49812.1"
FT                   /translation="MNRKLTLLLPLALLAACSQTPAPAGTGGDDVAPAAAKAADQQTLA
FT                   HLDAQRLQSQHWLLQQATAADGKRIDALFAREDKPVTLDFADGRLSVSNACNHMGGGYT
FT                   LADGKLTVSAMASTMMACTDKALMALDEAVSSRLQGELKAEQDADGKLTLTNAKGDVLV
FT                   FNPEPTAETRYGGAGETVFLEVAAKTEKCSHPLIPDYQCLQVREVKFDDKGLKQGEPGK
FT                   FENFYGNIEGYTHEDGVRNVVRVKRYEVKNPPADAPSQAYVLDMVVESAIEKK"
     MNRKLTLLLP LALLAACSQT PAPAGTGGDD VAPAAAKAAD QQTLAHLDAQ RLQSQHWLLQ        60
     QATAADGKRI DALFAREDKP VTLDFADGRL SVSNACNHMG GGYTLADGKL TVSAMASTMM       120
     ACTDKALMAL DEAVSSRLQG ELKAEQDADG KLTLTNAKGD VLVFNPEPTA ETRYGGAGET       180
     VFLEVAAKTE KCSHPLIPDY QCLQVREVKF DDKGLKQGEP GKFENFYGNI EGYTHEDGVR       240
     NVVRVKRYEV KNPPADAPSQ AYVLDMVVES AIEKK                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page