(data stored in ACNUC7421 zone)

EMBL: CP001111.PE108

CP001111.PE108       Location/Qualifiers
FT   CDS             complement(131457..132251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0108"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   xcb:XC_0193 undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49813"
FT                   /db_xref="GOA:B4SRU3"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRU3"
FT                   /protein_id="ACF49813.1"
FT                   /translation="MSDLLSALLLGILEGLTEFLPISSTGHLLIAQHWLGARSDFFNIV
FT                   IQAGAIVAVVLVFRQRLLQLATGFGQRENREYVFKLGAAFLVTAVVGLVVRKAGWSLPE
FT                   TVSPVAWALIIGGIWMLLVEAYTARLPDRDQVTWTVAIGVGLAQVVAGVFPGTSRSASA
FT                   IFLAMLLGLSRRAAAAEFVFLVGIPTMFAASAYTFLEMAKAGQLGSENWTEVGVAFLAA
FT                   AVTGFVVVKWLMGYIKSHKFTAFALYRIALGAALLLWLPSGS"
     MSDLLSALLL GILEGLTEFL PISSTGHLLI AQHWLGARSD FFNIVIQAGA IVAVVLVFRQ        60
     RLLQLATGFG QRENREYVFK LGAAFLVTAV VGLVVRKAGW SLPETVSPVA WALIIGGIWM       120
     LLVEAYTARL PDRDQVTWTV AIGVGLAQVV AGVFPGTSRS ASAIFLAMLL GLSRRAAAAE       180
     FVFLVGIPTM FAASAYTFLE MAKAGQLGSE NWTEVGVAFL AAAVTGFVVV KWLMGYIKSH       240
     KFTAFALYRI ALGAALLLWL PSGS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page