(data stored in ACNUC7421 zone)

EMBL: CP001111.PE109

CP001111.PE109       Location/Qualifiers
FT   CDS             132476..133885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0109"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: xcb:XC_0194 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49814"
FT                   /db_xref="GOA:B4SRU4"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU4"
FT                   /protein_id="ACF49814.1"
FT                   /translation="MSVENVEKLIKDNQIEFVDLRFVDMRGVEQHVTFPVSIVEPSLFE
FT                   EGKMFDGSSIAGWKGIAESDMVLLPDTASAYVDPFYADPTIVISCDILDPATMQPYGRC
FT                   PRGIAKRAEAYLKSSGIAETAFFGPEPEFFIFDSVRFANEMGHTFFQVDSEEAAWNSGA
FT                   KYDGANSGYRPGVKGGYFPVPPTDTLHDLRAEMCKTLEQVGIEVEVQHHEVATAGQCEI
FT                   GTKFSTLVQKADELLRMKYVIKNVAHRNGKTVTFMPKPIVGDNGSGMHVHQSLSKGGTN
FT                   LFSGDGYGGLSQLALWYIGGIFKHAKAINAFANSGTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASCRIPWVSNPKARRIEMRFPDPIQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYD
FT                   LPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAAT
FT                   HPLEYQLYYAS"
     MSVENVEKLI KDNQIEFVDL RFVDMRGVEQ HVTFPVSIVE PSLFEEGKMF DGSSIAGWKG        60
     IAESDMVLLP DTASAYVDPF YADPTIVISC DILDPATMQP YGRCPRGIAK RAEAYLKSSG       120
     IAETAFFGPE PEFFIFDSVR FANEMGHTFF QVDSEEAAWN SGAKYDGANS GYRPGVKGGY       180
     FPVPPTDTLH DLRAEMCKTL EQVGIEVEVQ HHEVATAGQC EIGTKFSTLV QKADELLRMK       240
     YVIKNVAHRN GKTVTFMPKP IVGDNGSGMH VHQSLSKGGT NLFSGDGYGG LSQLALWYIG       300
     GIFKHAKAIN AFANSGTNSY KRLVPGYEAP VMLAYSARNR SASCRIPWVS NPKARRIEMR       360
     FPDPIQSGYL TFTALMMAGL DGIKNQIDPG APSDKDLYDL PPEEEKLIPQ VCSSLDQALE       420
     ALDKDREFLK AGGVMSDDFI DGYIALKMQE VTKFRAATHP LEYQLYYAS                   469
//

If you have problems or comments...

PBIL Back to PBIL home page