(data stored in ACNUC7421 zone)

EMBL: CP001111.PE11

CP001111.PE11        Location/Qualifiers
FT   CDS             12857..13270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0011"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xom:XOO_0011 biopolymer transport ExbD2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49716"
FT                   /db_xref="GOA:B4SR15"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR15"
FT                   /protein_id="ACF49716.1"
FT                   /translation="MAFSSGGGKGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPQLVEPPPPIELKIDASNQVSWNNSPINASELQQRMEQEVQRDPTNQPEL
FT                   RIDASPDSEYDVMAKVLAAAKNAQMKKIGFVQQ"
     MAFSSGGGKG PMADINVTPL VDVMLVLLII FIVTAPIMTY PIAVDLPQRV LNPPPQLVEP        60
     PPPIELKIDA SNQVSWNNSP INASELQQRM EQEVQRDPTN QPELRIDASP DSEYDVMAKV       120
     LAAAKNAQMK KIGFVQQ                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page