(data stored in ACNUC7421 zone)

EMBL: CP001111.PE110

CP001111.PE110       Location/Qualifiers
FT   CDS             134155..134493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0110"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   xac:XAC0205 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49815"
FT                   /db_xref="GOA:B4SRU5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU5"
FT                   /protein_id="ACF49815.1"
FT                   /translation="MKLISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRIRT
FT                   GEIGADAL"
     MKLISAIIRP FKLDEVREAL SDAGVSGITV TEVKGFGRQK GHTELYRGAE YVVDFLPKIK        60
     IETVVTDERA DAVIEAIQSS AGTGKIGDGK IFVTAVEQVI RIRTGEIGAD AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page