(data stored in ACNUC7421 zone)

EMBL: CP001111.PE112

CP001111.PE112       Location/Qualifiers
FT   CDS             136241..137965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0112"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: xfa:XF2550 outer membrane hemolysin activator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49817"
FT                   /db_xref="GOA:B4SRU7"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU7"
FT                   /protein_id="ACF49817.1"
FT                   /translation="MEQGRNVRSRALQWRLSVAVALAMAGFQAPAWAQVVSPEQELLRQ
FT                   QERERALREQQESTPDVRLQPATEDLGHLPADESPCFTINSIVLQGDLAERFRWALAAA
FT                   DPRSDPATGRCLGTAGVDIVMKRVQNAIIERGYVTTRILAAPQDLKTGILTLTVVPGRV
FT                   NAIRFADGEGRTPALWNAVRVARGEVLNLRDIEQALENLQRVPTATVDIQIAPPADGAA
FT                   AKPGESDLVISWQQARLVRVNLTLDDAGSQSTGKMQAGTTVSVDNAAGLSDLFYINVGK
FT                   SVLNGSERGTDSWAVHYSVPLGGWLLGANASNFDYEQTVAGAFENYVYSGSSRNAELRL
FT                   TRMLFRNARAKTSMYARGWYRESDNFINDTEIEVQRRRMAGWELGLGHRHFIGKATLDV
FT                   NLAYRKGTGAFNALRAPEEAFGEGTAHGRIYTADAQLLLPLQWGKQSLRYVGSWRAQWN
FT                   RSPLVPQDRFSIGGRYTVRGFDGEMSLTGERGWLLRNEVGVPLGSGVEAYVAVDHGRVA
FT                   GPSTARLLGDRLTGTALGLRGGTRHVNWDAFVGSPLSRPRGFQTAYTTFGMNLGISF"
     MEQGRNVRSR ALQWRLSVAV ALAMAGFQAP AWAQVVSPEQ ELLRQQERER ALREQQESTP        60
     DVRLQPATED LGHLPADESP CFTINSIVLQ GDLAERFRWA LAAADPRSDP ATGRCLGTAG       120
     VDIVMKRVQN AIIERGYVTT RILAAPQDLK TGILTLTVVP GRVNAIRFAD GEGRTPALWN       180
     AVRVARGEVL NLRDIEQALE NLQRVPTATV DIQIAPPADG AAAKPGESDL VISWQQARLV       240
     RVNLTLDDAG SQSTGKMQAG TTVSVDNAAG LSDLFYINVG KSVLNGSERG TDSWAVHYSV       300
     PLGGWLLGAN ASNFDYEQTV AGAFENYVYS GSSRNAELRL TRMLFRNARA KTSMYARGWY       360
     RESDNFINDT EIEVQRRRMA GWELGLGHRH FIGKATLDVN LAYRKGTGAF NALRAPEEAF       420
     GEGTAHGRIY TADAQLLLPL QWGKQSLRYV GSWRAQWNRS PLVPQDRFSI GGRYTVRGFD       480
     GEMSLTGERG WLLRNEVGVP LGSGVEAYVA VDHGRVAGPS TARLLGDRLT GTALGLRGGT       540
     RHVNWDAFVG SPLSRPRGFQ TAYTTFGMNL GISF                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page