(data stored in ACNUC7421 zone)

EMBL: CP001111.PE117

CP001111.PE117       Location/Qualifiers
FT   CDS             complement(155019..156728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0117"
FT                   /product="C-terminal ATPase domain signal transduction-like
FT                   protein"
FT                   /note="KEGG: fjo:Fjoh_4494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49822"
FT                   /db_xref="GOA:B4SRV2"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV2"
FT                   /protein_id="ACF49822.1"
FT                   /translation="MQIPRTLAVLAVLLAAVAVWLLVSTPPPGLVQVPGAQMALANIGT
FT                   AGAVPARPPQDLHWRPLDQRELAAWRGPYWLRWQVPAPTTADVHGRTMRLSLRAASQLY
FT                   WNGNPWVSNGVVGRSAAEERPGRIDLVRVLPPASGNRSDELIVLASSQRQHFHLHGADA
FT                   MVLIAPATVLYGQIILPWLIAAFATGALAAACLYFLTVLRGQTQAPGARLLLALGAVGL
FT                   ALPVVEAWRSLLGYPYPWHGPRLVALLCLHVAAAALLPAYLARRFAVAMPRAVYLGYLA
FT                   VIIAAAVALPGFDTRSAAVLLSSLLASAGALLRAHCESEDRWPILALLLAGLLALLVAG
FT                   GAFLDGPYFLLLAVLMVFLLLRHAAQLQALDRHNAWLSEERARLSLQLLQRGIQPHWLM
FT                   NTLTCLQELIEQAPARASRLVESLADQFDRLRDSSDRRSVSLQDELALCRSHLDIVGMA
FT                   LDQRMRLEVDGEDAMLSLPPGILHAQVENALTHAGALACAKHPFHLRVQRTNARWILEL
FT                   RSARGSAPHRGRGTGTRYIEASLAAACPGGWTFVQGAEGDHWRSRIELTCAS"
     MQIPRTLAVL AVLLAAVAVW LLVSTPPPGL VQVPGAQMAL ANIGTAGAVP ARPPQDLHWR        60
     PLDQRELAAW RGPYWLRWQV PAPTTADVHG RTMRLSLRAA SQLYWNGNPW VSNGVVGRSA       120
     AEERPGRIDL VRVLPPASGN RSDELIVLAS SQRQHFHLHG ADAMVLIAPA TVLYGQIILP       180
     WLIAAFATGA LAAACLYFLT VLRGQTQAPG ARLLLALGAV GLALPVVEAW RSLLGYPYPW       240
     HGPRLVALLC LHVAAAALLP AYLARRFAVA MPRAVYLGYL AVIIAAAVAL PGFDTRSAAV       300
     LLSSLLASAG ALLRAHCESE DRWPILALLL AGLLALLVAG GAFLDGPYFL LLAVLMVFLL       360
     LRHAAQLQAL DRHNAWLSEE RARLSLQLLQ RGIQPHWLMN TLTCLQELIE QAPARASRLV       420
     ESLADQFDRL RDSSDRRSVS LQDELALCRS HLDIVGMALD QRMRLEVDGE DAMLSLPPGI       480
     LHAQVENALT HAGALACAKH PFHLRVQRTN ARWILELRSA RGSAPHRGRG TGTRYIEASL       540
     AAACPGGWTF VQGAEGDHWR SRIELTCAS                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page