(data stored in ACNUC7421 zone)

EMBL: CP001111.PE120

CP001111.PE120       Location/Qualifiers
FT   CDS             159702..160004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49825"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV5"
FT                   /protein_id="ACF49825.1"
FT                   /translation="MKYAKPNAKTNSKKYYKHWAESSLGKGNVLMEARGEKIVRQVEIY
FT                   GAKVVWADETGQSDDRFVLADQPVSFMDFDEDDEISAREFESAWKKAREATGYPV"
     MKYAKPNAKT NSKKYYKHWA ESSLGKGNVL MEARGEKIVR QVEIYGAKVV WADETGQSDD        60
     RFVLADQPVS FMDFDEDDEI SAREFESAWK KAREATGYPV                             100
//

If you have problems or comments...

PBIL Back to PBIL home page