(data stored in ACNUC7421 zone)

EMBL: CP001111.PE121

CP001111.PE121       Location/Qualifiers
FT   CDS             160084..162129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0121"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC0690 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49826"
FT                   /db_xref="GOA:B4SRV6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV6"
FT                   /protein_id="ACF49826.1"
FT                   /translation="MKTSTLVAALAAAPFAPEALAQSADAALTLGKVDVHQHGEGQLSA
FT                   HQVLTSVDVLGADQIEDRNVSHSWELLGQMPGIQLTETRQGAESGKVSFRAFNGEGYLN
FT                   AIKTLIDGIPSNVNSGNQRYIDMLFPLEISYIEVVRGTNDPRYGLHNIGGNVNFGTRQG
FT                   GNYTDARLAYGSYNTRDAQLAVGREANGVAQNYFVGTQASDGYRDHDTSRKYSLGGKWF
FT                   LGTLDDGLRVGLTARAYHHEADEPGFMTVEEMRTHRRGSDLRNGNDGDDRDMRQIAAHL
FT                   DMKLSERLTFGTRLYYNRYEDDRRVTFSDLPTGNLPRQRRVWDERQNGLLSTVTWQASP
FT                   ALTVEGGLNYEQQDNSYIRERYAYAEPTDFSRAPARVQNNDRHSFDNWGAYVQAIYQPV
FT                   EAWKIVPAYRVDRFSGRTHLMNGLSARLQDYGSIGQPKLSVIHSLGENTHVYANWGRTF
FT                   QVLTGSTAPAYLAPGQARMRPSTNTGMELGLKFQPFAGSQARLAVWQQDAENEVSNMPA
FT                   TGTTVTLGKTRRRGVDAQLSLQLGDDWTVWASHAYQEAKITRDDRDASMSLRGREVAAT
FT                   PRHISNLGVDYHASDALRLGLQARAQGDYYLEERNVAGKFGGFAVLDLSAAYQITPRWS
FT                   VDLQLKNVTGRQYAYAWYDSFFWDSARPMFSPAPGRSVFVGLNMKL"
     MKTSTLVAAL AAAPFAPEAL AQSADAALTL GKVDVHQHGE GQLSAHQVLT SVDVLGADQI        60
     EDRNVSHSWE LLGQMPGIQL TETRQGAESG KVSFRAFNGE GYLNAIKTLI DGIPSNVNSG       120
     NQRYIDMLFP LEISYIEVVR GTNDPRYGLH NIGGNVNFGT RQGGNYTDAR LAYGSYNTRD       180
     AQLAVGREAN GVAQNYFVGT QASDGYRDHD TSRKYSLGGK WFLGTLDDGL RVGLTARAYH       240
     HEADEPGFMT VEEMRTHRRG SDLRNGNDGD DRDMRQIAAH LDMKLSERLT FGTRLYYNRY       300
     EDDRRVTFSD LPTGNLPRQR RVWDERQNGL LSTVTWQASP ALTVEGGLNY EQQDNSYIRE       360
     RYAYAEPTDF SRAPARVQNN DRHSFDNWGA YVQAIYQPVE AWKIVPAYRV DRFSGRTHLM       420
     NGLSARLQDY GSIGQPKLSV IHSLGENTHV YANWGRTFQV LTGSTAPAYL APGQARMRPS       480
     TNTGMELGLK FQPFAGSQAR LAVWQQDAEN EVSNMPATGT TVTLGKTRRR GVDAQLSLQL       540
     GDDWTVWASH AYQEAKITRD DRDASMSLRG REVAATPRHI SNLGVDYHAS DALRLGLQAR       600
     AQGDYYLEER NVAGKFGGFA VLDLSAAYQI TPRWSVDLQL KNVTGRQYAY AWYDSFFWDS       660
     ARPMFSPAPG RSVFVGLNMK L                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page