(data stored in ACNUC7421 zone)

EMBL: CP001111.PE122

CP001111.PE122       Location/Qualifiers
FT   CDS             162245..163306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0122"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: xcb:XC_0197
FT                   two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49827"
FT                   /db_xref="GOA:B4SRV7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV7"
FT                   /protein_id="ACF49827.1"
FT                   /translation="MSDPAPPPSLDALGTPLAWAGADGRIIGCNPAFARWLGVSIRRLL
FT                   GQPLAALEVQGEALAHFLARDERDSLRLNRLALAVPGEAPRFAEGWMSRRDDGGWLLEA
FT                   HPVDEFPGLDPTQALPSALSAALKGLAHELRNPLAGLKGAAQLLARRAAQRDASERELI
FT                   ELIGSEIERLNGLLDQLLSPAPAAPHAELNIHAALERVLRLAENEAGWAVRLQRDYDPS
FT                   IPEFHGDADRLTQAVWNLVRNAIQAGAGNITLRTRVEHGVRIAEQLHTLALRLEIADDG
FT                   RGVPEELAEHLFLPLVSGRAEGTGLGLALAQQVAREHRGTLTYRSRPGHTVFTLLLPIG
FT                   NGAAPAEEAPRDV"
     MSDPAPPPSL DALGTPLAWA GADGRIIGCN PAFARWLGVS IRRLLGQPLA ALEVQGEALA        60
     HFLARDERDS LRLNRLALAV PGEAPRFAEG WMSRRDDGGW LLEAHPVDEF PGLDPTQALP       120
     SALSAALKGL AHELRNPLAG LKGAAQLLAR RAAQRDASER ELIELIGSEI ERLNGLLDQL       180
     LSPAPAAPHA ELNIHAALER VLRLAENEAG WAVRLQRDYD PSIPEFHGDA DRLTQAVWNL       240
     VRNAIQAGAG NITLRTRVEH GVRIAEQLHT LALRLEIADD GRGVPEELAE HLFLPLVSGR       300
     AEGTGLGLAL AQQVAREHRG TLTYRSRPGH TVFTLLLPIG NGAAPAEEAP RDV              353
//

If you have problems or comments...

PBIL Back to PBIL home page