(data stored in ACNUC7421 zone)

EMBL: CP001111.PE123

CP001111.PE123       Location/Qualifiers
FT   CDS             163299..164747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0123"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: xcb:XC_0198 two-component system regulatory
FT                   protein; TIGRFAM: nitrogen regulation protein NR(I); PFAM:
FT                   response regulator receiver; sigma-54 factor interaction
FT                   domain-containing protein; helix-turn-helix Fis-type;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49828"
FT                   /db_xref="GOA:B4SRV8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV8"
FT                   /protein_id="ACF49828.1"
FT                   /translation="MSDASTPAQRIWVVDDDRAVRFVLCTALREAGYQVVDFDSAAPAL
FT                   QALSEGPPPALLFTDVRMPGDDGLVLLDKLKAVLPQLPVVVMSAYTDVASTAGAFRGGA
FT                   HEFLSKPFDLDDAVALAQRVLPAVAPAMAAAAPTTATSSDQPPQLVGDTPPMRALFRAI
FT                   GRLAQAPLAVLITGETGTGKELVAHALHRESPRAQAPFVALNTAAIPAELLESELFGHE
FT                   AGAFTGAQRRHIGRFEQANGGTLFLDEIGDMPLPLQTRLLRVLAQGEFFRVGGRELIRV
FT                   DVRVVAATHQDLEGLVAQGKFRADLLHRLDVVRLQLPPLRERREDIAQLANTFLAAAAR
FT                   KLDTPPKRLTAAALQALREHDWPGNVRELENVCWRMAALAAADTIGVADVDTALNRTRG
FT                   RRSSTTSADPGQWEALLAEWARRQLAEGVEGLHAQVRERVDHALLEAALQITHGRRAEA
FT                   AARLGLGRNTLTRKLGAGRRRGGH"
     MSDASTPAQR IWVVDDDRAV RFVLCTALRE AGYQVVDFDS AAPALQALSE GPPPALLFTD        60
     VRMPGDDGLV LLDKLKAVLP QLPVVVMSAY TDVASTAGAF RGGAHEFLSK PFDLDDAVAL       120
     AQRVLPAVAP AMAAAAPTTA TSSDQPPQLV GDTPPMRALF RAIGRLAQAP LAVLITGETG       180
     TGKELVAHAL HRESPRAQAP FVALNTAAIP AELLESELFG HEAGAFTGAQ RRHIGRFEQA       240
     NGGTLFLDEI GDMPLPLQTR LLRVLAQGEF FRVGGRELIR VDVRVVAATH QDLEGLVAQG       300
     KFRADLLHRL DVVRLQLPPL RERREDIAQL ANTFLAAAAR KLDTPPKRLT AAALQALREH       360
     DWPGNVRELE NVCWRMAALA AADTIGVADV DTALNRTRGR RSSTTSADPG QWEALLAEWA       420
     RRQLAEGVEG LHAQVRERVD HALLEAALQI THGRRAEAAA RLGLGRNTLT RKLGAGRRRG       480
     GH                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page