(data stored in ACNUC7421 zone)

EMBL: CP001111.PE129

CP001111.PE129       Location/Qualifiers
FT   CDS             complement(169716..171011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0129"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: xac:XAC0214
FT                   porphyrin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49834"
FT                   /db_xref="GOA:B4SRW4"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW4"
FT                   /protein_id="ACF49834.1"
FT                   /translation="MKPLQSLVVLLLAVAIGVVAAQWLGADDLNRFGEVTLRYGGYDYH
FT                   SNLPKVALLSVVAVLVLWLLWSLIAAPFRAWGRYRRKQGRVRLIDGLQAYEHGQWQRAE
FT                   KLLDGAAKDPEVSAVALANAVRSAQARADGAAGEALLQRLGESDATLQALLRAEQLLAR
FT                   DLPVDAINALDVAAIQPLPPRGLWLRTEALAQAGRAHEAYGQLGALRQSKVLPADANSE
FT                   LEARLAAQALLEAADVNALAAQWEATPKALRPTPDVVGAYASRAVALSWDEPALLALEH
FT                   ALDQRWDDELVALYGRLPAERLATRQANLARWRNVHDSSAALRLAQGRVALGQQQWDAA
FT                   DAFLHEAIAAGAGAPAWEALGELFAQRGDHALAAQCLANALRLQRGEDSVELVRGTEAP
FT                   LRATVEEQPVTVQPPVYDANEERDEFGNPRLP"
     MKPLQSLVVL LLAVAIGVVA AQWLGADDLN RFGEVTLRYG GYDYHSNLPK VALLSVVAVL        60
     VLWLLWSLIA APFRAWGRYR RKQGRVRLID GLQAYEHGQW QRAEKLLDGA AKDPEVSAVA       120
     LANAVRSAQA RADGAAGEAL LQRLGESDAT LQALLRAEQL LARDLPVDAI NALDVAAIQP       180
     LPPRGLWLRT EALAQAGRAH EAYGQLGALR QSKVLPADAN SELEARLAAQ ALLEAADVNA       240
     LAAQWEATPK ALRPTPDVVG AYASRAVALS WDEPALLALE HALDQRWDDE LVALYGRLPA       300
     ERLATRQANL ARWRNVHDSS AALRLAQGRV ALGQQQWDAA DAFLHEAIAA GAGAPAWEAL       360
     GELFAQRGDH ALAAQCLANA LRLQRGEDSV ELVRGTEAPL RATVEEQPVT VQPPVYDANE       420
     ERDEFGNPRL P                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page