(data stored in ACNUC7421 zone)

EMBL: CP001111.PE13

CP001111.PE13        Location/Qualifiers
FT   CDS             14922..15191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49718"
FT                   /db_xref="GOA:B4SR17"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR17"
FT                   /protein_id="ACF49718.1"
FT                   /translation="MYWLYLLLALGCFAFALKTPNAGLMTLCLLAALAFLLAWVRGRYV
FT                   ARFGDLQRDPATLVDAEELRRLREQAQARRSAAPDEHDPSPLSK"
     MYWLYLLLAL GCFAFALKTP NAGLMTLCLL AALAFLLAWV RGRYVARFGD LQRDPATLVD        60
     AEELRRLREQ AQARRSAAPD EHDPSPLSK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page