(data stored in ACNUC7421 zone)

EMBL: CP001111.PE130

CP001111.PE130       Location/Qualifiers
FT   CDS             complement(171018..171992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49835"
FT                   /db_xref="GOA:B4SRW5"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW5"
FT                   /protein_id="ACF49835.1"
FT                   /translation="MNETPPVSPPRRPVRWLLPLAGVVVLGVGGYAGWRFWHEQQDAQD
FT                   AQAQTTAVQLQGLEATLDALRRDQRATSQRLQDAAATNRVLRDEMLGLSQRSALLEENL
FT                   AKLADSANQGRQAVQRDEAELLLTQAAQRLNYSDDVEGARRLYAQAATALADLPDSDGL
FT                   NLRQALVQEREALDALGAGPRVQSLQRLDALAKALQGLPSQVTGSATANARPWWQATLA
FT                   PFVDITPSRQNGPLTAAERHNADDALQLELTLARAAIERGDRSGRDTALQRVEHWAQRR
FT                   WPDSPALRAQRAELKALRELPLQASNTVLGSTLQQLRTQTDRR"
     MNETPPVSPP RRPVRWLLPL AGVVVLGVGG YAGWRFWHEQ QDAQDAQAQT TAVQLQGLEA        60
     TLDALRRDQR ATSQRLQDAA ATNRVLRDEM LGLSQRSALL EENLAKLADS ANQGRQAVQR       120
     DEAELLLTQA AQRLNYSDDV EGARRLYAQA ATALADLPDS DGLNLRQALV QEREALDALG       180
     AGPRVQSLQR LDALAKALQG LPSQVTGSAT ANARPWWQAT LAPFVDITPS RQNGPLTAAE       240
     RHNADDALQL ELTLARAAIE RGDRSGRDTA LQRVEHWAQR RWPDSPALRA QRAELKALRE       300
     LPLQASNTVL GSTLQQLRTQ TDRR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page