(data stored in ACNUC7421 zone)

EMBL: CP001111.PE134

CP001111.PE134       Location/Qualifiers
FT   CDS             173924..174361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0134"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: xcb:XC_0212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49839"
FT                   /db_xref="GOA:B4SRW9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW9"
FT                   /protein_id="ACF49839.1"
FT                   /translation="MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKPA
FT                   ELTQLINAGGTVVVDLSASGDFEKGHIAGSRNAQASAFGPDNKLVANAKQSPVVLVCRS
FT                   GNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN"
     MNYEELLAFA GRNPMLSAAL VGLTVAIIVT EIRRLFRGFK GIKPAELTQL INAGGTVVVD        60
     LSASGDFEKG HIAGSRNAQA SAFGPDNKLV ANAKQSPVVL VCRSGNASET AAKALKKAGF       120
     EKVYVLDGGI PAWQQAELPL VKGRN                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page