(data stored in ACNUC7421 zone)

EMBL: CP001111.PE135

CP001111.PE135       Location/Qualifiers
FT   CDS             174462..174980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0135"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: xac:XAC0221 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49840"
FT                   /db_xref="GOA:B4SSF8"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SSF8"
FT                   /protein_id="ACF49840.1"
FT                   /translation="MSEETTNGAVAPADAATGPAFTVEKIYVKDVSFESPNAPTIFNDQ
FT                   VQPELQLNLNQQVQRLGENAFEVVLAVTLTCQAGERTAYVAEVKQAGVFGLVGLDPQSI
FT                   DVLLGTQCPNILFPYVRQLISDLIQAGGFPPFFLQPINFEGLYAETLRQRQEQGDAPSL
FT                   ADSEPAGNA"
     MSEETTNGAV APADAATGPA FTVEKIYVKD VSFESPNAPT IFNDQVQPEL QLNLNQQVQR        60
     LGENAFEVVL AVTLTCQAGE RTAYVAEVKQ AGVFGLVGLD PQSIDVLLGT QCPNILFPYV       120
     RQLISDLIQA GGFPPFFLQP INFEGLYAET LRQRQEQGDA PSLADSEPAG NA               172
//

If you have problems or comments...

PBIL Back to PBIL home page